PDB entry 6gzm

View 6gzm on RCSB PDB site
Description: Crystal Structure of Human CKIdelta with A86
Class: transferase
Keywords: CDK9, kinase inhibitor, A86, TRANSFERASE
Deposited on 2018-07-04, released 2018-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-29, with a file datestamp of 2018-08-24.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Casein kinase I isoform delta
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK1D, HCKID
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48730 (Start-294)
      • engineered mutation (12)
    Domains in SCOPe 2.07: d6gzma_
  • Chain 'B':
    Compound: Casein kinase I isoform delta
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK1D, HCKID
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48730 (0-294)
      • engineered mutation (12)
    Domains in SCOPe 2.07: d6gzmb_
  • Heterogens: LCI, CIT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gzmA (A:)
    melrvgnryrlgnkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmq
    ggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyih
    sknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtarya
    sinthlgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievl
    ckgypsefatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlkf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gzmA (A:)
    vgnryrlgnkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmqggvg
    iptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihsknf
    ihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtaryasint
    hlgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievlckgy
    psefatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlkf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6gzmB (B:)
    melrvgnryrlgnkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmq
    ggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyih
    sknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtarya
    sinthlgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievl
    ckgypsefatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlkf