PDB entry 6gzj

View 6gzj on RCSB PDB site
Description: complex between the dynein light chain dynll1/dlc8 and the specific domain of large myelin-associated glycoprotein l-mag
Deposited on 2018-07-04, released 2018-10-10
The last revision was dated 2019-01-09, with a file datestamp of 2019-01-04.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dynein light chain 1, cytoplasmic
    Species: Homo sapiens [TaxId:9606]
    Gene: DYNLL1, DLC1, DNCL1, DNCLC1, HDLC1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Myelin-associated glycoprotein
    Species: Mus musculus, synthetic [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6gzjA (A:)
smcdrkaviknadmseemqqdsvecatqalekyniekdiaahikkefdkkynptwhcivg
rnfgsyvthetkhfiyfylgqvaillfksg

    Sequence, based on observed residues (ATOM records):
    >6gzjA (A:)
cdrkaviknadmseemqqdsvecatqalekyniekdiaahikkefdkkynptwhcivgrn
fgsyvthetkhfiyfylgqvaillfksg

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6gzjB (B:)
sekrlgserrllglrgespeldlsyshsdlgkrptkdsytlteelaeyaeirvk

    Sequence, based on observed residues (ATOM records):
    >6gzjB (B:)
ptkdsytlte