PDB entry 6gzd

View 6gzd on RCSB PDB site
Description: Crystal structure of Human CSNK1A1 with A86
Class: transferase
Keywords: CKIa, Casein kinase, Kinase inhibitor, Transferase
Deposited on 2018-07-03, released 2018-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-29, with a file datestamp of 2018-08-24.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: casein kinase I isoform alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK1A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48729
      • conflict (56)
      • conflict (71)
      • conflict (94)
    Domains in SCOPe 2.07: d6gzda_
  • Heterogens: DMS, PGE, EDO, PEG, TCE, LCI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gzdA (A:)
    mgsshhhhhhssgvdlwshpqfekgtenlyfqggggrmasssgskaefivggkyklgrki
    gsgsfgdiylatnitngeevavklesqkarhpqlhyesklykilqggvgiphirwygqek
    dynvlvmdllgpsledlfnfcsrrftmktvlmladqmisrieyvhtknfihrdikpdnfl
    mgigrhcnklflidfglakkyrdnrtrqhipyredknltgtaryasinahlgieqsrrdd
    meslgyvlmyfnrtslpwqglkaatkkqkyekisekkmstpvevlckgfpaefamylnyc
    rglrfeeapdymylrqlfrilfrtlnhqydytfdwtmlkqkaaqqaasssgqgqqaqtpt
    gkqtdktksnmkgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gzdA (A:)
    aefivggkyklgrkigsgsfgdiylatnitngeevavklesqkarhpqlhyesklykilq
    ggvgiphirwygqekdynvlvmdllgpsledlfnfcsrrftmktvlmladqmisrieyvh
    tknfihrdikpdnflmgigrhcnklflidfglakkyrdnrtrqhipyredknltgtarya
    sinahlgieqsrrddmeslgyvlmyfnrtslpwqglkaatkkqkyekisekkmstpvevl
    ckgfpaefamylnycrglrfeeapdymylrqlfrilfrtlnhqydytfdwtmlkqka