PDB entry 6gza

View 6gza on RCSB PDB site
Description: structure of murine leukemia virus capsid c-terminal domain
Deposited on 2018-07-03, released 2018-12-05
The last revision was dated 2018-12-19, with a file datestamp of 2018-12-14.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: capsid protein
    Species: Murine leukemia virus [TaxId:11786]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: capsid protein
    Species: Murine leukemia virus [TaxId:11786]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6gzaA (A:)
sptnlakvkgitqgpnespsaflerlkeayrrytpydpedpgqetnvsmsfiwqsapdig
rklerledlksktlgdlvreaekifnk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6gzaB (B:)
sptnlakvkgitqgpnespsaflerlkeayrrytpydpedpgqetnvsmsfiwqsapdig
rklerledlksktlgdlvreaekifnk