PDB entry 6gz9

View 6gz9 on RCSB PDB site
Description: Crystal structure of a POT family transporter in complex with prodrug valacyclovir
Class: membrane protein
Keywords: Peptide transporter; prodrug complex, MEMBRANE PROTEIN
Deposited on 2018-07-03, released 2018-12-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-26, with a file datestamp of 2018-12-21.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptide ABC transporter permease
    Species: Staphylococcus hominis [TaxId:1290]
    Gene: BL313_09825
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1L8Y4Q3 (0-487)
      • conflict (249)
      • conflict (279)
    Domains in SCOPe 2.07: d6gz9a_
  • Heterogens: TXC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6gz9A (A:)
    qtiqsipqkgffghprglgvlffvefwerfsyygmramlifymyfaihqnglgidkttam
    simsvygaliymssipgawiadritgtrgatllgavliiighiclslpfalfglfssmff
    iiigsglmkpnisnivgrlypendtridagfvifymsvnlgalispiilqhfvdirnfhg
    gfllaaigmalglvwyllfnrknlgsvgmkptnplskeekrkygmiigiivaivivvllv
    tyythtlsfdlisntvlvlgvalpiiyfttmlrskdvtdgersrvkafiplfilgmlfws
    iqeqgsnvlniyglersdmqlnlfgwttrfgealfqsinplfillfapvismiwlkmgkk
    qpslaikfsigtllaglsyiliglvglgyghtqfsvnwvilsyvicvigelclsptgnsa
    avklapkafnaqmmsvwlltnasaqaingtlvklikplgqtnyfiflgtvaivitliilv
    fspkitka