PDB entry 6gz8

View 6gz8 on RCSB PDB site
Description: first germn domain of the sporulation protein germ from bacillus subtilis
Deposited on 2018-07-03, released 2018-10-10
The last revision was dated 2018-12-26, with a file datestamp of 2018-12-21.
Experiment type: XRAY
Resolution: 1 Å
R-factor: N/A
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Spore germination protein GerM
    Species: BACILLUS SUBTILIS SUBSP. SUBTILIS STR. 168 [TaxId:224308]
    Gene: gerM, BSU28380
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NA, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6gz8A (A:)
tvmrelylidkngyvvaqtlplpksestakqaleylvqggpvseilpngfravlpadttv
nvdikkdgtaiadfsnefknykkedeqkivqsvtwtltqfssidkvklringhelkempv
ggtpisddlsrkdginle

    Sequence, based on observed residues (ATOM records):
    >6gz8A (A:)
tvmrelylidkngyvvaqtlplpksestakqaleylvqggpvseilpngfravlpadttv
nvdikkdgtaiadfsnefknykkedeqkivqsvtwtltqfssidkvklringhelkempv
ggtpisddlsrkd