PDB entry 6gz0

View 6gz0 on RCSB PDB site
Description: Crystal Structure of the LeuO Effector Binding Domain
Class: transcription
Keywords: LTTR, Transcription Factor, Transcription, CRISPR
Deposited on 2018-07-02, released 2019-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-26, with a file datestamp of 2019-06-21.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HTH-type transcriptional regulator LeuO
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: leuO, b0076, JW0075
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gz0a_
  • Heterogens: SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gz0A (A:)
    msservfhlcvcspldsiltsqiynhieqiapnihvmfksslnqntehqlryqetefvis
    yedfhrpeftsvplfkdemvlvasknhptikgpllkhdvyneqhaavsldrfasfsqpwy
    dtvdkqasiayqgmammsvlsvvsqthlvaiaprwlaeefaeslelqvlplplkqnsrtc
    ylswheaagrdkghqwmeeqlvsickrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gz0A (A:)
    rvfhlcvcspldsiltsqiynhieqiapnihvmfksslnyqetefvisyedfhftsvplf
    kdemvlvasknhptikgpllkhdvyneqhaavsldrfasfsqpwydtvdkqasiayqgma
    mmsvlsvvsqthlvaiaprwlaeefaeslelqvlplplkqnsrtcylswheaagrdkghq
    wmeeqlvsickr