PDB entry 6gyt

View 6gyt on RCSB PDB site
Description: transcription factor dimerization activates the p300 acetyltransferase
Deposited on 2018-07-01, released 2018-10-17
The last revision was dated 2018-11-14, with a file datestamp of 2018-11-09.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone acetyltransferase p300
    Species: Homo sapiens [TaxId:9606]
    Gene: EP300, P300
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q09472 (0-121)
      • expression tag (122-160)
  • Chain 'B':
    Compound: Histone acetyltransferase p300
    Species: Homo sapiens [TaxId:9606]
    Gene: EP300, P300
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q09472 (2-123)
      • expression tag (0-1)
      • conflict (3)
      • conflict (92)
      • expression tag (124-167)
  • Chain 'C':
    Compound: histone h4
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • PDB 6GYT (0-8)
  • Heterogens: ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6gytA (A:)
kifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivkspmdlstikrkl
dtgqyqepwqyvddiwlmfnnawlynrktsrvykycsklsevfeqeidpvmqslgyccgr
klgelfvectecgrkmhqicvlhheiiwpagfvcdgclkks

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6gytB (B:)
agkafkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivkspmdlstikr
kldtgqyqepwqyvddiwlmfnnawlynrktsavykycsklsevfeqeidpvmqslgycc
grklgelfvectecgrkmhqicvlhheiiwpagfvcdgclkksartrk

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >6gytC (C:)
glgkggaka