PDB entry 6gyn

View 6gyn on RCSB PDB site
Description: structure of human hcn4 hyperpolarization-activated cyclic nucleotide- gated ion channel
Deposited on 2018-06-30, released 2019-05-08
The last revision was dated 2019-12-11, with a file datestamp of 2019-12-06.
Experiment type: EM
Resolution: 3.4 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4
    Species: Homo sapiens [TaxId:9606]
    Gene: HCN4
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4
    Species: Homo sapiens [TaxId:9606]
    Gene: HCN4
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4
    Species: Homo sapiens [TaxId:9606]
    Gene: HCN4
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4
    Species: Homo sapiens [TaxId:9606]
    Gene: HCN4
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PC1, 3PE

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6gynA (A:)
    smlpeaevrlgqagfmqrqfgamlqpgvnkfslrmfgsqkavereqervksagfwiihpy
    sdfrfywdltmlllmvgnliiipvgitffkdenttpwivfnvvsdtfflidlvlnfrtgi
    vvednteiildpqrikmkylkswfmvdfissipvdyiflivetridsevyktaralrivr
    ftkilsllrllrlsrliryihqweeifhmtydlasavvrivnligmmlllchwdgclqfl
    vpmlqdfpddcwvsinnmvnnswgkqysyalfkamshmlcigygrqapvgmsdvwltmls
    mivgatcyamfighataliqsldssrrqyqekykqveqymsfhklppdtrqrihdyyehr
    yqgkmfdeesilgelseplreeiinfncrklvasmplfanadpnfvtsmltklrfevfqp
    gdyiiregtigkkmyfiqhgvvsvltkgnketkladgsyfgeiclltrgrrtasvradty
    crlyslsvdnfnevleeypmmrrafetvaldrldrigkkns
    

    Sequence, based on observed residues (ATOM records):
    >6gynA (A:)
    mqrqfgamlqpgvnkfslrmfgsqkavereqervksagfwiihpysdfrfywdltmlllm
    vgnliiipvgitffkdenttpwivfnvvsdtfflidlvlnfrtgivvednteiildpqri
    kmkylkswfmvdfissipvdyiflivetridsevyktaralrivrftkilsllrllrlsr
    liryihqweeifhmtydlasavvrivnligmmlllchwdgclqflvpmlqdfpddcwvsi
    nnmvnnswgkqysyalfkamshmlcigygrqapvgmsdvwltmlsmivgatcyamfigha
    taliqsldssrrqyqekykqveqymsfhklppdtrqrihdyyehryqgkmfdeesilgel
    seplreeiinfncrklvasmplfanadpnfvtsmltklrfevfqpgdyiiregtigkkmy
    fiqhgvvsvltkgnketkladgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevl
    eeypmmrrafetval
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6gynB (B:)
    smlpeaevrlgqagfmqrqfgamlqpgvnkfslrmfgsqkavereqervksagfwiihpy
    sdfrfywdltmlllmvgnliiipvgitffkdenttpwivfnvvsdtfflidlvlnfrtgi
    vvednteiildpqrikmkylkswfmvdfissipvdyiflivetridsevyktaralrivr
    ftkilsllrllrlsrliryihqweeifhmtydlasavvrivnligmmlllchwdgclqfl
    vpmlqdfpddcwvsinnmvnnswgkqysyalfkamshmlcigygrqapvgmsdvwltmls
    mivgatcyamfighataliqsldssrrqyqekykqveqymsfhklppdtrqrihdyyehr
    yqgkmfdeesilgelseplreeiinfncrklvasmplfanadpnfvtsmltklrfevfqp
    gdyiiregtigkkmyfiqhgvvsvltkgnketkladgsyfgeiclltrgrrtasvradty
    crlyslsvdnfnevleeypmmrrafetvaldrldrigkkns
    

    Sequence, based on observed residues (ATOM records):
    >6gynB (B:)
    mqrqfgamlqpgvnkfslrmfgsqkavereqervksagfwiihpysdfrfywdltmlllm
    vgnliiipvgitffkdenttpwivfnvvsdtfflidlvlnfrtgivvednteiildpqri
    kmkylkswfmvdfissipvdyiflivetridsevyktaralrivrftkilsllrllrlsr
    liryihqweeifhmtydlasavvrivnligmmlllchwdgclqflvpmlqdfpddcwvsi
    nnmvnnswgkqysyalfkamshmlcigygrqapvgmsdvwltmlsmivgatcyamfigha
    taliqsldssrrqyqekykqveqymsfhklppdtrqrihdyyehryqgkmfdeesilgel
    seplreeiinfncrklvasmplfanadpnfvtsmltklrfevfqpgdyiiregtigkkmy
    fiqhgvvsvltkgnketkladgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevl
    eeypmmrrafetval
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6gynC (C:)
    smlpeaevrlgqagfmqrqfgamlqpgvnkfslrmfgsqkavereqervksagfwiihpy
    sdfrfywdltmlllmvgnliiipvgitffkdenttpwivfnvvsdtfflidlvlnfrtgi
    vvednteiildpqrikmkylkswfmvdfissipvdyiflivetridsevyktaralrivr
    ftkilsllrllrlsrliryihqweeifhmtydlasavvrivnligmmlllchwdgclqfl
    vpmlqdfpddcwvsinnmvnnswgkqysyalfkamshmlcigygrqapvgmsdvwltmls
    mivgatcyamfighataliqsldssrrqyqekykqveqymsfhklppdtrqrihdyyehr
    yqgkmfdeesilgelseplreeiinfncrklvasmplfanadpnfvtsmltklrfevfqp
    gdyiiregtigkkmyfiqhgvvsvltkgnketkladgsyfgeiclltrgrrtasvradty
    crlyslsvdnfnevleeypmmrrafetvaldrldrigkkns
    

    Sequence, based on observed residues (ATOM records):
    >6gynC (C:)
    mqrqfgamlqpgvnkfslrmfgsqkavereqervksagfwiihpysdfrfywdltmlllm
    vgnliiipvgitffkdenttpwivfnvvsdtfflidlvlnfrtgivvednteiildpqri
    kmkylkswfmvdfissipvdyiflivetridsevyktaralrivrftkilsllrllrlsr
    liryihqweeifhmtydlasavvrivnligmmlllchwdgclqflvpmlqdfpddcwvsi
    nnmvnnswgkqysyalfkamshmlcigygrqapvgmsdvwltmlsmivgatcyamfigha
    taliqsldssrrqyqekykqveqymsfhklppdtrqrihdyyehryqgkmfdeesilgel
    seplreeiinfncrklvasmplfanadpnfvtsmltklrfevfqpgdyiiregtigkkmy
    fiqhgvvsvltkgnketkladgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevl
    eeypmmrrafetval
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >6gynD (D:)
    smlpeaevrlgqagfmqrqfgamlqpgvnkfslrmfgsqkavereqervksagfwiihpy
    sdfrfywdltmlllmvgnliiipvgitffkdenttpwivfnvvsdtfflidlvlnfrtgi
    vvednteiildpqrikmkylkswfmvdfissipvdyiflivetridsevyktaralrivr
    ftkilsllrllrlsrliryihqweeifhmtydlasavvrivnligmmlllchwdgclqfl
    vpmlqdfpddcwvsinnmvnnswgkqysyalfkamshmlcigygrqapvgmsdvwltmls
    mivgatcyamfighataliqsldssrrqyqekykqveqymsfhklppdtrqrihdyyehr
    yqgkmfdeesilgelseplreeiinfncrklvasmplfanadpnfvtsmltklrfevfqp
    gdyiiregtigkkmyfiqhgvvsvltkgnketkladgsyfgeiclltrgrrtasvradty
    crlyslsvdnfnevleeypmmrrafetvaldrldrigkkns
    

    Sequence, based on observed residues (ATOM records):
    >6gynD (D:)
    mqrqfgamlqpgvnkfslrmfgsqkavereqervksagfwiihpysdfrfywdltmlllm
    vgnliiipvgitffkdenttpwivfnvvsdtfflidlvlnfrtgivvednteiildpqri
    kmkylkswfmvdfissipvdyiflivetridsevyktaralrivrftkilsllrllrlsr
    liryihqweeifhmtydlasavvrivnligmmlllchwdgclqflvpmlqdfpddcwvsi
    nnmvnnswgkqysyalfkamshmlcigygrqapvgmsdvwltmlsmivgatcyamfigha
    taliqsldssrrqyqekykqveqymsfhklppdtrqrihdyyehryqgkmfdeesilgel
    seplreeiinfncrklvasmplfanadpnfvtsmltklrfevfqpgdyiiregtigkkmy
    fiqhgvvsvltkgnketkladgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevl
    eeypmmrrafetval