PDB entry 6gyj

View 6gyj on RCSB PDB site
Description: Mouse thymidylate synthase crystal soaked in phenolphthalein
Class: transferase
Keywords: fragment screening, fragment, inhibitor, TRANSFERASE
Deposited on 2018-06-30, released 2019-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-28, with a file datestamp of 2019-08-23.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thymidylate synthase
    Species: Mus musculus [TaxId:10090]
    Gene: Tyms
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gyja_
  • Chain 'B':
    Compound: Thymidylate synthase
    Species: Mus musculus [TaxId:10090]
    Gene: Tyms
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gyjb_
  • Heterogens: FGT, SO4, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gyjA (A:)
    mlvvgselqsdaqqlsaeaprhgelqylrqvehilrcgfkkedrtgtgtlsvfgmqarys
    lrdefpllttkrvfwkgvleellwfikgstnakelsskgvriwdangsrdfldslgfsar
    qegdlgpvygfqwrhfgaeykdmdsdysgqgvdqlqkvidtiktnpddrriimcawnpkd
    lplmalppchalcqfyvvngelscqlyqrsgdmglgvpfniasyalltymiahitglqpg
    dfvhtlgdahiylnhieplkiqlqreprpfpklkilrkvetiddfkvedfqiegynphpt
    ikmemav
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gyjA (A:)
    rhgelqylrqvehilrcgfkkedrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvle
    ellwfikgstnakelsskgvriwdangsrdfldslgfsarqegdlgpvygfqwrhfgaey
    kdmdsdysgqgvdqlqkvidtiktnpddrriimcawnpkdlplmalppchalcqfyvvng
    elscqlyqrsgdmglgvpfniasyalltymiahitglqpgdfvhtlgdahiylnhieplk
    iqlqreprpfpklkilrkvetiddfkvedfqiegynphpt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6gyjB (B:)
    mlvvgselqsdaqqlsaeaprhgelqylrqvehilrcgfkkedrtgtgtlsvfgmqarys
    lrdefpllttkrvfwkgvleellwfikgstnakelsskgvriwdangsrdfldslgfsar
    qegdlgpvygfqwrhfgaeykdmdsdysgqgvdqlqkvidtiktnpddrriimcawnpkd
    lplmalppchalcqfyvvngelscqlyqrsgdmglgvpfniasyalltymiahitglqpg
    dfvhtlgdahiylnhieplkiqlqreprpfpklkilrkvetiddfkvedfqiegynphpt
    ikmemav
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gyjB (B:)
    hgelqylrqvehilrcgfkkedrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvlee
    llwfikgstnakelsskgvriwdangsrdfldslgfsarqegdlgpvygfqwrhfgaeyk
    dmdsdysgqgvdqlqkvidtiktnpddrriimcawnpkdlplmalppchalcqfyvvnge
    lscqlyqrsgdmglgvpfniasyalltymiahitglqpgdfvhtlgdahiylnhieplki
    qlqreprpfpklkilrkvetiddfkvedfqiegynphp