PDB entry 6gyi

View 6gyi on RCSB PDB site
Description: Azurin fom Pseudomonas aeruginosa treated with hydrosulfide
Class: electron transport
Keywords: copper protein, hydrosulfide sensor, ELECTRON TRANSPORT
Deposited on 2018-06-29, released 2019-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gyia_
  • Chain 'B':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gyib_
  • Chain 'C':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gyic_
  • Chain 'D':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gyid_
  • Heterogens: CU, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gyiA (A:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gyiA (A:)
    ecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvvt
    dgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsalm
    kgtltlk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6gyiB (B:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gyiB (B:)
    ecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvvt
    dgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsalm
    kgtltlk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6gyiC (C:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6gyiD (D:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gyiD (D:)
    ecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvvt
    dgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsalm
    kgtltlk