PDB entry 6gy4

View 6gy4 on RCSB PDB site
Description: crystal structure of the n-terminal kh domain of human bicc1
Deposited on 2018-06-28, released 2018-07-18
The last revision was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein bicaudal C homolog 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BICC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H694 (2-End)
      • expression tag (0-1)
  • Chain 'B':
    Compound: Protein bicaudal C homolog 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BICC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H694 (2-85)
      • expression tag (0-1)
  • Chain 'C':
    Compound: Protein bicaudal C homolog 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BICC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H694 (2-End)
      • expression tag (0-1)
  • Chain 'D':
    Compound: Protein bicaudal C homolog 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BICC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H694 (2-End)
      • expression tag (0-1)
  • Heterogens: SO4, XPE, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6gy4A (A:)
    smseerfrvdrkkleamlqaaaegkgrsgedffqkimeetntqiawpsklkigakskkdp
    hikvsgkkedvkeakemimsvldtks
    

    Sequence, based on observed residues (ATOM records):
    >6gy4A (A:)
    smseerfrvdrkkleamlqaaaegedffqkimeetntqiawpdphikvsgkkedvkeake
    mimsvldt
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6gy4B (B:)
    smseerfrvdrkkleamlqaaaegkgrsgedffqkimeetntqiawpsklkigakskkdp
    hikvsgkkedvkeakemimsvldtks
    

    Sequence, based on observed residues (ATOM records):
    >6gy4B (B:)
    smseerfrvdrkkleamlqaaaegkgrdffqkimeetntqiawpsklkigakdphikvsg
    kkedvkeakemimsvldtks
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6gy4C (C:)
    smseerfrvdrkkleamlqaaaegkgrsgedffqkimeetntqiawpsklkigakskkdp
    hikvsgkkedvkeakemimsvldtks
    

    Sequence, based on observed residues (ATOM records):
    >6gy4C (C:)
    smseerfrvdrkkleamlqaaaegedffqkimeetntqiawpsklkigadphikvsgkke
    dvkeakemimsvldt
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >6gy4D (D:)
    smseerfrvdrkkleamlqaaaegkgrsgedffqkimeetntqiawpsklkigakskkdp
    hikvsgkkedvkeakemimsvldtks
    

    Sequence, based on observed residues (ATOM records):
    >6gy4D (D:)
    smseerfrvdrkkleamlqaaaegdffqkimeetntqiawpskkdphikvsgkkedvkea
    kemimsvldt