PDB entry 6gxy

View 6gxy on RCSB PDB site
Description: Tryparedoxin from Trypanosoma brucei in complex with CFT
Class: oxidoreductase
Keywords: Covalent Inhibitor, Photoreduction, Inhibitor-Induced Dimerization, Monomer-Dimer Mixture, OXIDOREDUCTASE
Deposited on 2018-06-27, released 2019-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tryparedoxin
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O77404 (3-145)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d6gxya1, d6gxya2
  • Chain 'B':
    Compound: tryparedoxin
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O77404 (3-145)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d6gxyb1, d6gxyb2
  • Chain 'C':
    Compound: tryparedoxin
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O77404 (3-145)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d6gxyc1, d6gxyc2
  • Heterogens: FFN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gxyA (A:)
    gmgsglakylpgatnllsksgevslgslvgktvflyfsaswcppcrgftpvlaefyekhh
    vaknfevvliswdenesdfhdyygkmpwlalpfdqrstvselgktfgvesiptlitinad
    tgaiigtqartrviedpdganfpwpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gxyA (A:)
    mgsglakylpgatnllsksgevslgslvgktvflyfsaswcppcrgftpvlaefyekhhv
    aknfevvliswdenesdfhdyygkmpwlalpfdqrstvselgktfgvesiptlitinadt
    gaiigtqartrviedpdganfpwpn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6gxyB (B:)
    gmgsglakylpgatnllsksgevslgslvgktvflyfsaswcppcrgftpvlaefyekhh
    vaknfevvliswdenesdfhdyygkmpwlalpfdqrstvselgktfgvesiptlitinad
    tgaiigtqartrviedpdganfpwpn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6gxyC (C:)
    gmgsglakylpgatnllsksgevslgslvgktvflyfsaswcppcrgftpvlaefyekhh
    vaknfevvliswdenesdfhdyygkmpwlalpfdqrstvselgktfgvesiptlitinad
    tgaiigtqartrviedpdganfpwpn