PDB entry 6gxe

View 6gxe on RCSB PDB site
Description: Carbonic Anhydrase CAIX mimic in complex with inhibitor JS14
Class: lyase
Keywords: Carbonic Anhydrase, CAII mutant to CAIX mimic, CA Inhibitor, lyase
Deposited on 2018-06-27, released 2019-05-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00918 (0-256)
      • conflict (61)
      • conflict (63)
      • conflict (65)
      • conflict (87)
      • conflict (126)
      • conflict (165)
      • conflict (199)
    Domains in SCOPe 2.08: d6gxea_
  • Heterogens: ZN, FFH, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6gxeA (A:)
hwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnng
hsfqvtfddsqdkavlkggpldgtyrllqfhfhwgsldgqgsehtvdkkkyaaelhlvhw
ntkygdvgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktegksadftnfdprgl
lpesldywtypgslttpplaecvtwivlkepisvsseqvlkfrklnfngegepeelmvdn
wrpaqplknrqikasfk