PDB entry 6gx6

View 6gx6 on RCSB PDB site
Description: crystal structure of imp3 rrm12 in complex with rna (acac)
Deposited on 2018-06-26, released 2018-09-05
The last revision was dated 2018-11-28, with a file datestamp of 2018-11-23.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Insulin-like growth factor 2 mRNA-binding protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: IGF2BP3, IMP3, KOC1, VICKZ3
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00425 (3-End)
      • expression tag (1-2)
  • Chain 'B':
    Compound: RNA (5'-r(*ap*cp*ap*c)-3')
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
  • Heterogens: EDO, PO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6gx6A (A:)
ggsmnklyignlsenaapsdlesifkdakipvsgpflvktgyafvdcpdeswalkaieal
sgkielhgkpievehsvpkrqrirklqirnipphlqwevldsllvqygvvesceqvntds
etavvnvtysskdqarqaldklngfqlenftlkvayipdemaaqhhhhhh

    Sequence, based on observed residues (ATOM records):
    >6gx6A (A:)
gsmnklyignlsenaapsdlesifkdakipvsgpflvktgyafvdcpdeswalkaieals
gkielhgkpievehsvpkrqrirklqirnipphlqwevldsllvqygvvesceqvntdse
tavvnvtysskdqarqaldklngfqlenftlkvayipde

  • Chain 'B':
    No sequence available.