PDB entry 6gx2

View 6gx2 on RCSB PDB site
Description: Blood group synthase AAGlyB in complex with UDP-GalNAc and cryoprotected with glycerol
Class: transferase
Keywords: blood group synthase, glycosyltransferase, dual specificity, cis-AB mutant, transferase
Deposited on 2018-06-26, released 2019-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-10, with a file datestamp of 2019-07-05.
Experiment type: XRAY
Resolution: 1.07 Å
R-factor: N/A
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ABO blood group (Transferase A, alpha 1-3-N-acetylgalactosaminyltransferase transferase B, alpha 1-3-galactosyltransferase)
    Species: Homo sapiens [TaxId:9606]
    Gene: ABO
    Database cross-references and differences (RAF-indexed):
    • Uniprot F0X360 (7-297)
      • expression tag (1-6)
      • engineered mutation (209)
    Domains in SCOPe 2.07: d6gx2a1, d6gx2a2
  • Heterogens: MN, UDP, GOL, EDO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gx2A (A:)
    maigefmvslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqntti
    gltvfaikkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevr
    aykrwqdvsmrrmemisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpgf
    ygssreaftyerrpqsqayipkdegdfyyggaffggsvqevqrltrachqammvdqangi
    eavwhdeshlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavpknhqavrnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gx2A (A:)
    aigefmvslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttig
    ltvfaikkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevra
    ykrwqdvsmrrmemisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpgfy
    gssreaftyerrpqsqayipkdegdfyyggaffggsvqevqrltrachqammvdqangie
    avwhdeshlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavpknhqavrnp