PDB entry 6gwu

View 6gwu on RCSB PDB site
Description: Carbonic anhydrase CaNce103p from Candida albicans
Class: lyase
Keywords: Carbonic anhydrase, Candida albicans, CaNce103p, substrate tunnel, LYASE
Deposited on 2018-06-26, released 2018-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-07, with a file datestamp of 2018-11-02.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carbonic anhydrase
    Species: Candida albicans [TaxId:5476]
    Gene: NCE103, CAALFM_C301300CA, CaO19.1721, CaO19.9289
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gwua_
  • Chain 'B':
    Compound: carbonic anhydrase
    Species: Candida albicans [TaxId:5476]
    Gene: NCE103, CAALFM_C301300CA, CaO19.1721, CaO19.9289
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gwub_
  • Chain 'C':
    Compound: carbonic anhydrase
    Species: Candida albicans [TaxId:5476]
    Gene: NCE103, CAALFM_C301300CA, CaO19.1721, CaO19.9289
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gwuc_
  • Chain 'D':
    Compound: carbonic anhydrase
    Species: Candida albicans [TaxId:5476]
    Gene: NCE103, CAALFM_C301300CA, CaO19.1721, CaO19.9289
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gwud_
  • Heterogens: ZN, BME, PEG, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6gwuA (A:)
    nfpftlssestlqdflnnnkffvdsikhnhgnqifdlngqgqsphtlwigcsdsragdqc
    latlpgeifvhrnianivnandissqgviqfaidvlkvkkiivcghtdcggiwaslskkk
    iggvldlwlnpvrhiraanlklleeynqdpklkakklaelnvissvtalkrhpsasvalk
    kneievwgmlydvatgylsqveipqdef
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6gwuB (B:)
    nfpftlssestlqdflnnnkffvdsikhnhgnqifdlngqgqsphtlwigcsdsragdqc
    latlpgeifvhrnianivnandissqgviqfaidvlkvkkiivcghtdcggiwaslskkk
    iggvldlwlnpvrhiraanlklleeynqdpklkakklaelnvissvtalkrhpsasvalk
    kneievwgmlydvatgylsqveipqdef
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gwuB (B:)
    nfpftlssestlqdflnnnkffvdsikhnhgnqifdlngqgqsphtlwigcsdsragdqc
    latlpgeifvhrnianivnandissqgviqfaidvlkvkkiivcghtdcggiwaslskkk
    iggvldlwlnpvrhiraanlklleeynqdpklkakklaelnvissvtalkrhpsasvalk
    kneievwgmlydvatgylsqveipq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6gwuC (C:)
    nfpftlssestlqdflnnnkffvdsikhnhgnqifdlngqgqsphtlwigcsdsragdqc
    latlpgeifvhrnianivnandissqgviqfaidvlkvkkiivcghtdcggiwaslskkk
    iggvldlwlnpvrhiraanlklleeynqdpklkakklaelnvissvtalkrhpsasvalk
    kneievwgmlydvatgylsqveipqdef
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gwuC (C:)
    nfpftlssestlqdflnnnkffvdsikhnhgnqifdlngqgqsphtlwigcsdsragdqc
    latlpgeifvhrnianivnandissqgviqfaidvlkvkkiivcghtdcggiwaslskkk
    iggvldlwlnpvrhiraanlklleeynqdpklkakklaelnvissvtalkrhpsasvalk
    kneievwgmlydvatgylsqveip
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6gwuD (D:)
    nfpftlssestlqdflnnnkffvdsikhnhgnqifdlngqgqsphtlwigcsdsragdqc
    latlpgeifvhrnianivnandissqgviqfaidvlkvkkiivcghtdcggiwaslskkk
    iggvldlwlnpvrhiraanlklleeynqdpklkakklaelnvissvtalkrhpsasvalk
    kneievwgmlydvatgylsqveipqdef
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gwuD (D:)
    fpftlssestlqdflnnnkffvdsikhnhgnqifdlngqgqsphtlwigcsdsragdqcl
    atlpgeifvhrnianivnandissqgviqfaidvlkvkkiivcghtdcggiwaslskkki
    ggvldlwlnpvrhiraanlklleeynqdpklkakklaelnvissvtalkrhpsasvalkk
    neievwgmlydvatgylsqvei