PDB entry 6gwr

View 6gwr on RCSB PDB site
Description: Structure of the kinase domain of human DDR1 in complex with a potent and selective inhibitor of DDR1 and DDR2
Class: peptide binding protein
Keywords: WNK2, CCT Domain, AI domain, RFXV motif binding, PEPTIDE BINDING PROTEIN
Deposited on 2018-06-25, released 2018-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-08, with a file datestamp of 2018-08-03.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: epithelial discoidin domain-containing receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: DDR1, CAK, EDDR1, NEP, NTRK4, PTK3A, RTK6, TRKE
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08345 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.07: d6gwra1, d6gwra2
  • Chain 'B':
    Compound: epithelial discoidin domain-containing receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: DDR1, CAK, EDDR1, NEP, NTRK4, PTK3A, RTK6, TRKE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gwrb_
  • Heterogens: FEW, SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gwrA (A:)
    smprvdfprsrlrfkeklgegqfgevhlcevdspqdlvsldfplnvrkghpllvavkilr
    pdatknarndflkevkimsrlkdpniirllgvcvqddplcmitdymengdlnqflsahql
    edkaaegapgdgqaaqgptisypmllhvaaqiasgmrylatlnfvhrdlatrnclvgenf
    tikiadfgmsrnlyagdyyrvqgravlpirwmawecilmgkfttasdvwafgvtlwevlm
    lcraqpfgqltdeqvienageffrdqgrqvylsrppacpqglyelmlrcwsreseqrppf
    sqlhrflaedalntv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gwrA (A:)
    mprvdfprsrlrfkeklgegqfgevhlcevdspqdlvsldfplghpllvavkilrpdatk
    narndflkevkimsrlkdpniirllgvcvqddplcmitdymengdlnqflsahqledkaa
    eqgptisypmllhvaaqiasgmrylatlnfvhrdlatrnclvgenftikiadfgmsrnly
    agdyyrvqgravlpirwmawecilmgkfttasdvwafgvtlwevlmlcraqpfgqltdeq
    vienageffrdqgrqvylsrppacpqglyelmlrcwsreseqrppfsqlhrflaedalnt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6gwrB (B:)
    smprvdfprsrlrfkeklgegqfgevhlcevdspqdlvsldfplnvrkghpllvavkilr
    pdatknarndflkevkimsrlkdpniirllgvcvqddplcmitdymengdlnqflsahql
    edkaaegapgdgqaaqgptisypmllhvaaqiasgmrylatlnfvhrdlatrnclvgenf
    tikiadfgmsrnlyagdyyrvqgravlpirwmawecilmgkfttasdvwafgvtlwevlm
    lcraqpfgqltdeqvienageffrdqgrqvylsrppacpqglyelmlrcwsreseqrppf
    sqlhrflaedalntv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gwrB (B:)
    rvdfprsrlrfkeklgegqfgevhlcevdspqdlvspllvavkilrpdatknarndflke
    vkimsrlkdpniirllgvcvqddplcmitdymengdlnqflsahqledkaagptisypml
    lhvaaqiasgmrylatlnfvhrdlatrnclvgenftikiadfgmsrnlyagdyyrvqgra
    vlpirwmawecilmgkfttasdvwafgvtlwevlmlcraqpfgqltdeqvienageffrd
    qgrqvylsrppacpqglyelmlrcwsreseqrppfsqlhrflaed