PDB entry 6gwn

View 6gwn on RCSB PDB site
Description: Crystal Structure of Stabilized Active Plasminogen Activator Inhibitor-1 (PAI-1-W175F) in Complex with Two Inhibitory Nanobodies (VHH-2g-42, VHH-2w-64)
Class: hydrolase
Keywords: plasminogen activator inhibitor-1, PAI-1, PAI-1-W175F, serpin, protease inhibitor, serine protease inhibitor, nanobody, antibody fragment, protein complex, hydrolase
Deposited on 2018-06-25, released 2020-01-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-01-01, with a file datestamp of 2019-12-27.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Plasminogen activator inhibitor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SERPINE1, PAI1, PLANH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05121 (0-378)
      • engineered mutation (174)
    Domains in SCOPe 2.07: d6gwna_
  • Chain 'B':
    Compound: VHH-2g-42
    Species: VICUGNA PACOS [TaxId:30538]
    Database cross-references and differences (RAF-indexed):
    • PDB 6GWN (0-End)
    Domains in SCOPe 2.07: d6gwnb_
  • Chain 'C':
    Compound: VHH-2w-64
    Species: VICUGNA PACOS [TaxId:30538]
    Database cross-references and differences (RAF-indexed):
    • PDB 6GWN
    Domains in SCOPe 2.07: d6gwnc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gwnA (A:)
    vhhppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqa
    amgfkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrst
    vkqvdfseverarfiindwvkthtkgmisnllgkgavdqltrlvlvnalyfngqfktpfp
    dssthrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaap
    yekevplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfr
    qfqadftslsdqeplhvaqalqkvkievnesgtvassstavivsarmapeeiimdrpflf
    vvrhnptgtvlfmgqvmep
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gwnA (A:)
    vhhppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqa
    amgfkiddkgmapalrhlykelmkdeisttdaifvqrdlklvqgfmphffrlfrstvkqv
    dfseverarfiindwvkthtkgmisnllgkgavdqltrlvlvnalyfngqfktpfpdsst
    hrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyeke
    vplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfqa
    dftslsdqeplhvaqalqkvkievnesgtvpeeiimdrpflfvvrhnptgtvlfmgqvme
    p
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6gwnB (B:)
    qvqlvesggglvqpggrlrlscaasgftfrtyamqwyrqspgterelvaaisniggvtdy
    gdsvkgrftisrdnakttvylemnslkpedtatyycsavrlpqrywgrgtqvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gwnB (B:)
    qvqlvesggglvqpggrlrlscaasgftfrtyamqwyrqspgterelvaaisniggvtdy
    gdsvkgrftisrdnakttvylemnslkpedtatyycsavrlpqrywgrgtqvtvs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6gwnC (C:)
    qvqlvesggglvqaggslrlscaasgftfddysiawfrqapgkeregvscisssdgsayy
    adsvkgrftissdnakntvylqmnslkpedtavyycaavwarvcrnpydywgqgtqvtvs
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gwnC (C:)
    vqlvesggglvqaggslrlscaasgftfddysiawfrqapgkeregvscisssdgsayya
    dsvkgrftissdnakntvylqmnslkpedtavyycaavwarvcrnpydywgqgtqvtvs