PDB entry 6gwm

View 6gwm on RCSB PDB site
Description: solution structure of rat rip2 caspase recruitment domain
Deposited on 2018-06-25, released 2018-10-31
The last revision was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: receptor-interacting serine/threonine-protein kinase 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Ripk2, rCG_54865
    Database cross-references and differences (RAF-indexed):
    • Uniprot G3V783 (18-124)
      • initiating methionine (0)
      • expression tag (1-17)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6gwmA (A:)
mhhhhhhgsgsglvprgsgiaqqwiqskreaivsqmteaclnqsldallsrdlimkedye
listkptrtakvrqlldtsdiqgeefarvivqklkdnkqmglqpypevllvsrtpssnvl
qnktl