SCOPe 2.08: Structural Classification of Proteins

PDB entry 6gwk

View 6gwk on RCSB PDB site
Description: The crystal structure of Hfq from Caulobacter crescentus
Class: RNA binding protein
Keywords: Hfq, Caulobacter, sRNA, RNA-protein interactions, natively unstructured protein, RNA BINDING PROTEIN
Deposited on 2018-06-25, released 2019-05-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-06-12, with a file datestamp of 2019-06-07.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: RNA-binding protein Hfq
Species: Caulobacter vibrioides CB15 [TaxId:190650]
Gene: hfq, CC_1745
Database cross-references and differences (RAF-indexed):
- Uniprot Q9A7H8
Domains in SCOPe 2.08: d6gwka_
Chain 'B':
Compound: RNA-binding protein Hfq
Species: Caulobacter vibrioides CB15 [TaxId:190650]
Gene: hfq, CC_1745
Database cross-references and differences (RAF-indexed):
- Uniprot Q9A7H8 (Start-81)
Domains in SCOPe 2.08: d6gwkb_
Chain 'C':
Compound: RNA-binding protein Hfq
Species: Caulobacter vibrioides CB15 [TaxId:190650]
Gene: hfq, CC_1745
Database cross-references and differences (RAF-indexed):
- Uniprot Q9A7H8
Domains in SCOPe 2.08: d6gwkc_
Chain 'D':
Compound: RNA-binding protein Hfq
Species: Caulobacter vibrioides CB15 [TaxId:190650]
Gene: hfq, CC_1745
Database cross-references and differences (RAF-indexed):
- Uniprot Q9A7H8 (Start-81)
Domains in SCOPe 2.08: d6gwkd_
Chain 'E':
Compound: RNA-binding protein Hfq
Species: Caulobacter vibrioides CB15 [TaxId:190650]
Gene: hfq, CC_1745
Database cross-references and differences (RAF-indexed):
- Uniprot Q9A7H8
Domains in SCOPe 2.08: d6gwke_
Chain 'F':
Compound: RNA-binding protein Hfq
Species: Caulobacter vibrioides CB15 [TaxId:190650]
Gene: hfq, CC_1745
Database cross-references and differences (RAF-indexed):
- Uniprot Q9A7H8
Domains in SCOPe 2.08: d6gwkf_
Chain 'G':
Compound: RNA-binding protein Hfq
Species: Caulobacter vibrioides CB15 [TaxId:190650]
Gene: hfq, CC_1745
Database cross-references and differences (RAF-indexed):
- Uniprot Q9A7H8
Domains in SCOPe 2.08: d6gwkg_
Chain 'H':
Compound: RNA-binding protein Hfq
Species: Caulobacter vibrioides CB15 [TaxId:190650]
Gene: hfq, CC_1745
Database cross-references and differences (RAF-indexed):
- Uniprot Q9A7H8 (Start-81)
Domains in SCOPe 2.08: d6gwkh_
Chain 'I':
Compound: RNA-binding protein Hfq
Species: Caulobacter vibrioides CB15 [TaxId:190650]
Gene: hfq, CC_1745
Database cross-references and differences (RAF-indexed):
- Uniprot Q9A7H8
Domains in SCOPe 2.08: d6gwki_
Chain 'J':
Compound: RNA-binding protein Hfq
Species: Caulobacter vibrioides CB15 [TaxId:190650]
Gene: hfq, CC_1745
Database cross-references and differences (RAF-indexed):
- Uniprot Q9A7H8 (Start-81)
Domains in SCOPe 2.08: d6gwkj_
Chain 'K':
Compound: RNA-binding protein Hfq
Species: Caulobacter vibrioides CB15 [TaxId:190650]
Gene: hfq, CC_1745
Database cross-references and differences (RAF-indexed):
- Uniprot Q9A7H8
Domains in SCOPe 2.08: d6gwkk_
Chain 'L':
Compound: RNA-binding protein Hfq
Species: Caulobacter vibrioides CB15 [TaxId:190650]
Gene: hfq, CC_1745
Database cross-references and differences (RAF-indexed):
- Uniprot Q9A7H8
Domains in SCOPe 2.08: d6gwkl_
Chain 'M':
Compound: RNA-binding protein Hfq
Species: Caulobacter vibrioides CB15 [TaxId:190650]
Gene: hfq, CC_1745
Database cross-references and differences (RAF-indexed):
- Uniprot Q9A7H8
Domains in SCOPe 2.08: d6gwkm_
Chain 'N':
Compound: RNA-binding protein Hfq
Species: Caulobacter vibrioides CB15 [TaxId:190650]
Gene: hfq, CC_1745
Database cross-references and differences (RAF-indexed):
- Uniprot Q9A7H8 (Start-81)
Domains in SCOPe 2.08: d6gwkn_
Chain 'O':
Compound: RNA-binding protein Hfq
Species: Caulobacter vibrioides CB15 [TaxId:190650]
Gene: hfq, CC_1745
Database cross-references and differences (RAF-indexed):
- Uniprot Q9A7H8
Domains in SCOPe 2.08: d6gwko_
Chain 'P':
Compound: RNA-binding protein Hfq
Species: Caulobacter vibrioides CB15 [TaxId:190650]
Gene: hfq, CC_1745
Database cross-references and differences (RAF-indexed):
- Uniprot Q9A7H8 (Start-81)
Domains in SCOPe 2.08: d6gwkp_
Chain 'Q':
Compound: RNA-binding protein Hfq
Species: Caulobacter vibrioides CB15 [TaxId:190650]
Gene: hfq, CC_1745
Database cross-references and differences (RAF-indexed):
- Uniprot Q9A7H8
Domains in SCOPe 2.08: d6gwkq_
Chain 'R':
Compound: RNA-binding protein Hfq
Species: Caulobacter vibrioides CB15 [TaxId:190650]
Gene: hfq, CC_1745
Database cross-references and differences (RAF-indexed):
- Uniprot Q9A7H8
Domains in SCOPe 2.08: d6gwkr_
Chain 'S':
Compound: RNA-binding protein Hfq
Species: Caulobacter vibrioides CB15 [TaxId:190650]
Gene: hfq, CC_1745
Database cross-references and differences (RAF-indexed):
- Uniprot Q9A7H8
Domains in SCOPe 2.08: d6gwks_
Chain 'T':
Compound: RNA-binding protein Hfq
Species: Caulobacter vibrioides CB15 [TaxId:190650]
Gene: hfq, CC_1745
Database cross-references and differences (RAF-indexed):
- Uniprot Q9A7H8 (Start-81)
Domains in SCOPe 2.08: d6gwkt_
Chain 'U':
Compound: RNA-binding protein Hfq
Species: Caulobacter vibrioides CB15 [TaxId:190650]
Gene: hfq, CC_1745
Database cross-references and differences (RAF-indexed):
- Uniprot Q9A7H8
Domains in SCOPe 2.08: d6gwku_
Chain 'V':
Compound: RNA-binding protein Hfq
Species: Caulobacter vibrioides CB15 [TaxId:190650]
Gene: hfq, CC_1745
Database cross-references and differences (RAF-indexed):
- Uniprot Q9A7H8 (Start-81)
Domains in SCOPe 2.08: d6gwkv_
Chain 'W':
Compound: RNA-binding protein Hfq
Species: Caulobacter vibrioides CB15 [TaxId:190650]
Gene: hfq, CC_1745
Database cross-references and differences (RAF-indexed):
- Uniprot Q9A7H8
Domains in SCOPe 2.08: d6gwkw_
Chain 'X':
Compound: RNA-binding protein Hfq
Species: Caulobacter vibrioides CB15 [TaxId:190650]
Gene: hfq, CC_1745
Database cross-references and differences (RAF-indexed):
- Uniprot Q9A7H8
Domains in SCOPe 2.08: d6gwkx_
Heterogens: HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>6gwkA (A:)
msaekkqnlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykh
aistimpaqpvqlyepsadadd