PDB entry 6gwg

View 6gwg on RCSB PDB site
Description: Alpha-galactosidase from Thermotoga maritima in complex with cyclohexene-based carbasugar mimic of galactose covalently linked to the nucleophile
Class: hydrolase
Keywords: glycoside hydrolase, galactosidase, carbohydrate processing enzyme, inhibitor, HYDROLASE
Deposited on 2018-06-24, released 2018-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-22, with a file datestamp of 2018-08-17.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-galactosidase
    Species: Thermotoga maritima MSB8 [TaxId:243274]
    Gene: galA, TM_1192, Tmari_1199
    Database cross-references and differences (RAF-indexed):
    • Uniprot G4FEF4 (23-End)
      • expression tag (16-22)
    Domains in SCOPe 2.07: d6gwga1, d6gwga2, d6gwga3
  • Heterogens: FEK, SO4, MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gwgA (A:)
    mgsshhhhhhssglvprgshmasmeifgktfregrfvlkeknftvefavekihlgwkisg
    rvkgspgrlevlrtkapekvlvnnwqswgpcrvvdafsfkppeidpnwrytasvvpdvle
    rnlqsdyfvaeegkvygflsskiahpffavedgelvayleyfdvefddfvpleplvvled
    pntplllekyaelvgmennarvpkhtptgwcswyhyfldltweetlknlklaknfpfevf
    qiddayekdigdwlvtrgdfpsveemakviaengfipgiwtapfsvsetsdvfnehpdwv
    vkengepkmayrnwnkkiyaldlskdevlnwlfdlfsslrkmgyryfkidflfagavpge
    rkknitpiqafrkgietirkavgedsfilgcgspllpavgcvdgmrigpdtapfwgehie
    dngapaarwalrnaitryfmhdrfwlndpdclilreektdltqkekelysytcgvldnmi
    iesddlslvrdhgkkvlketlellggrprvqnimsedlryeivssgtlsgnvkivvdlns
    reyhlekegksslkkrvvkredgrnfyfyeegere
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gwgA (A:)
    rgshmasmeifgktfregrfvlkeknftvefavekihlgwkisgrvkgspgrlevlrtka
    pekvlvnnwqswgpcrvvdafsfkppeidpnwrytasvvpdvlernlqsdyfvaeegkvy
    gflsskiahpffavedgelvayleyfdvefddfvpleplvvledpntplllekyaelvgm
    ennarvpkhtptgwcswyhyfldltweetlknlklaknfpfevfqiddayekdigdwlvt
    rgdfpsveemakviaengfipgiwtapfsvsetsdvfnehpdwvvkengepkmayrnwnk
    kiyaldlskdevlnwlfdlfsslrkmgyryfkidflfagavpgerkknitpiqafrkgie
    tirkavgedsfilgcgspllpavgcvdgmrigpdtapfwgehiedngapaarwalrnait
    ryfmhdrfwlndpdclilreektdltqkekelysytcgvldnmiiesddlslvrdhgkkv
    lketlellggrprvqnimsedlryeivssgtlsgnvkivvdlnsreyhleke