PDB entry 6gw9

View 6gw9 on RCSB PDB site
Description: Concanavalin A structure determined with data from the EuXFEL, the first MHz free electron laser
Class: sugar binding protein
Keywords: Free-electron laser, serial crystallography, lectin, SUGAR BINDING PROTEIN
Deposited on 2018-06-22, released 2018-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-05, with a file datestamp of 2018-08-31.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Concanavalin V
    Species: Canavalia cathartica [TaxId:28958]
    Database cross-references and differences (RAF-indexed):
    • Uniprot C0HJY1 (0-236)
      • conflict (57)
      • conflict (69)
      • conflict (128)
      • conflict (191)
    Domains in SCOPe 2.07: d6gw9a_
  • Heterogens: MG, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gw9A (A:)
    adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
    lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
    hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
    iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gw9A (A:)
    adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
    lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksntn
    alhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvhiwes
    savvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan