PDB entry 6gw8

View 6gw8 on RCSB PDB site
Description: Zn(II) form of shortened metallothionein from Pseudomonas fluorescens Q2-87 (residues 1-52)
Class: metal binding protein
Keywords: metallothionein, zinc(II) ion, METAL BINDING PROTEIN
Deposited on 2018-06-22, released 2018-09-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: metallothionein
    Species: Pseudomonas fluorescens Q2-87 [TaxId:1038922]
    Gene: PflQ2_2045
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6gw8a_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6gw8A (A:)
    nelrcgcpdchckvdpervfnhdgeaycsqacaeqhpngepcpapdchcers