PDB entry 6gw7

View 6gw7 on RCSB PDB site
Description: the ctd of hpdpra, a dna binding winged helix domain which do not bind dsdna
Deposited on 2018-06-22, released 2019-04-24
The last revision was dated 2020-11-18, with a file datestamp of 2020-11-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA protecting protein DprA
    Species: Helicobacter pylori [TaxId:210]
    Gene: BB415_01075
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A2A6XLY0 (1-56)
      • initiating methionine (0)
      • expression tag (57-58)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6gw7A (A:)
    mlkdyhlkempemedefleycaknpsyeeaylkfgdklleyellgkikrinhivvlahh