PDB entry 6gvz

View 6gvz on RCSB PDB site
Description: GII.1 human norovirus protruding domain in complex with glycochenodeoxycholate (GCDCA)
Class: viral protein
Keywords: Norovirus, GII.1, P domain, GCDCA, HBGA, VIRAL PROTEIN
Deposited on 2018-06-21, released 2018-10-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Capsid protein VP1
    Species: Norovirus Hu/GII.1/7EK/Hawaii/1971/USA [TaxId:1208060]
    Gene: VP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot J9XXB7 (4-304)
      • expression tag (0-3)
    Domains in SCOPe 2.08: d6gvza1, d6gvza2
  • Heterogens: CHO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6gvzA (A:)
gpgskpftlpiltigelsnsrfpvpidelytspnegvivqpqngrstldgellgttqlvp
snicalrgrinaqvpddhhqwnlqvtntngtpfdptedvpaplgtpdflaniygvtsqrn
pnntcrahdgvlatwspkftpklgsvilgtweesdldlnqptrftpvglfntdhfdqwal
psysgrltlnmnlapsvsplfpgeqllffrshiplkggtsdgaidcllpqewiqhfyqes
apsptdvalirytnpdtgrvlfeaklhrqgfitvansgsrpivvppngyfrfdswvnqfy
slapm