PDB entry 6gvx

View 6gvx on RCSB PDB site
Description: Crystal structure of Maternal Embryonic Leucine Zipper Kinase (MELK) in complex with dorsomorphin (Compound C)
Class: oncoprotein
Keywords: dorsomorphin, MELK, inhibitor, cancer, ONCOPROTEIN
Deposited on 2018-06-21, released 2019-05-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-29, with a file datestamp of 2019-05-24.
Experiment type: XRAY
Resolution: 2.24 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: maternal embryonic leucine zipper kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: MELK, KIAA0175
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14680 (4-End)
      • expression tag (0-3)
    Domains in SCOPe 2.07: d6gvxa1, d6gvxa2
  • Chain 'B':
    Compound: maternal embryonic leucine zipper kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: MELK, KIAA0175
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14680 (4-End)
      • expression tag (0-3)
    Domains in SCOPe 2.07: d6gvxb1, d6gvxb2
  • Heterogens: EDO, TAK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gvxA (A:)
    plgsmkdydellkyyelhetigtggfakvklachiltgemvaikimdkntlgsdlprikt
    eiealknlrhqhicqlyhvletankifmvleycpggelfdyiisqdrlseeetrvvfrqi
    vsavayvhsqgyahrdlkpenllfdeyhklklidfglcakpkgnkdyhlqtccgslayaa
    peliqgksylgseadvwsmgillyvlmcgflpfdddnvmalykkimrgkydvpkwlspss
    illlqqmlqvdpkkrismknllnhpwimqdynypvewqsknpfihldddcvtelsvhhrn
    nrqtmedlislwqydhltatyllllakkargkpvrlrlssfscg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gvxA (A:)
    plgsmkdydellkyyelhetigtfakvklachiltgemvaikimdkntdlprikteieal
    knlrhqhicqlyhvletankifmvleycpggelfdyiisqdrlseeetrvvfrqivsava
    yvhsqgyahrdlkpenllfdeyhklklidfglcakpkgnkcgslayaapeliqgkgsead
    vwsmgillyvlmcgflpfdddnvmalykkimrgkydvpkwlspssilllqqmlqvdpkkr
    ismknllnhpwimqdynypvewqsknpfihldddcvtelrqtmedlislwqydhltatyl
    lllakkargkpvrlr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6gvxB (B:)
    plgsmkdydellkyyelhetigtggfakvklachiltgemvaikimdkntlgsdlprikt
    eiealknlrhqhicqlyhvletankifmvleycpggelfdyiisqdrlseeetrvvfrqi
    vsavayvhsqgyahrdlkpenllfdeyhklklidfglcakpkgnkdyhlqtccgslayaa
    peliqgksylgseadvwsmgillyvlmcgflpfdddnvmalykkimrgkydvpkwlspss
    illlqqmlqvdpkkrismknllnhpwimqdynypvewqsknpfihldddcvtelsvhhrn
    nrqtmedlislwqydhltatyllllakkargkpvrlrlssfscg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gvxB (B:)
    plgsmkdydellkyyelhetigtgakvklachiltgemvaikimdkntsdlprikteiea
    lknlrhqhicqlyhvletankifmvleycpggelfdyiisqdrlseeetrvvfrqivsav
    ayvhsqgyahrdlkpenllfdeyhklklidfglcakpgslayaapeliqggseadvwsmg
    illyvlmcgflpfdddnvmalykkimrgkydvpkwlspssilllqqmlqvdpkkrismkn
    llnhpwimqdynypvewqsknpfihldddcvtelsvhhrnnrqtmedlislwqydhltat
    yllllakkargkpvrlrls