PDB entry 6gvu

View 6gvu on RCSB PDB site
Description: nmr structure of the dna-bound helix bundle domain from the functional prn1 primase
Deposited on 2018-06-21, released 2018-12-26
The last revision was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA (5'-d(*cp*tp*gp*tp*gp*cp*tp*cp*a)-3')
    Species: Sulfolobus islandicus, synthetic [TaxId:43080]
  • Chain 'B':
    Compound: functional pRN1 primase
    Species: Sulfolobus islandicus [TaxId:43080]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6gvuB (B:)
tvvefeelrkelvkrdsgkpvekikeeictksppklikeiicenktyadvnidrsrgdwh
vilylmkhgvtdpdkilellprdskakenekwntqkyfvitlskawsvvkkylea