PDB entry 6gvl

View 6gvl on RCSB PDB site
Description: second pair of fibronectin type iii domains of integrin beta4 bound to the bullous pemphigoid antigen bp230 (bpag1e)
Deposited on 2018-06-21, released 2019-03-20
The last revision was dated 2019-06-19, with a file datestamp of 2019-06-14.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Integrin beta-4
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGB4
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Dystonin
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6gvlA (A:)
    gshmvpdtptrlvfsalgptslrvswqeprcerplqgysveyqllnggelhrlnipnpaq
    tsvvvedllpnhsyvfrvraqsqegwgreregvitiesqvhpqsplcplpgsaftlstps
    apgplvftalspdslqlswerprrpngdivgylvtcemaqgggpatafrvdgdspesrlt
    vpglsenvpykfkvqarttegfgperegiities
    

    Sequence, based on observed residues (ATOM records):
    >6gvlA (A:)
    vpdtptrlvfsalgptslrvswqeprcplqgysveyqllnggelhrlnipnpaqtsvvve
    dllpnhsyvfrvraqsqegwgreregvitiesqlpgsaftlstpsapgplvftalspdsl
    qlswerprrpngdivgylvtcemaqgggpatafrvdgdspesrltvpglsenvpykfkvq
    arttegfgperegiities
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6gvlB (B:)
    dsnenlllvhcgptlinscisfgsesfdgh
    

    Sequence, based on observed residues (ATOM records):
    >6gvlB (B:)
    snenlllvhcgptlinscisfgs