PDB entry 6gvj

View 6gvj on RCSB PDB site
Description: Human Mps1 kinase domain with ordered activation loop
Class: transferase
Keywords: MPS1, TTK, KINASE, MITOSIS CHECKPOINT, TRANSFERASE, Activation loop, activation segment
Deposited on 2018-06-21, released 2019-01-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-03-20, with a file datestamp of 2019-03-15.
Experiment type: XRAY
Resolution: 2.4099999999999997 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dual specificity protein kinase TTK
    Species: Homo sapiens [TaxId:9606]
    Gene: TTK, MPS1, MPS1L1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6gvja1, d6gvja2
  • Heterogens: GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gvjA (A:)
    mahhhhhhsaalevlfqgpgpaassnhwqipelarkvnteqkhttfeqpvfsvskqsppi
    stskwfdpksicktpssntlddymscfrtpvvkndfppacqlstpygqpacfqqqqhqil
    atplqnlqvlasssanecisvkgriysilkqigsggsskvfqvlnekkqiyaikyvnlee
    adnqtldsyrneiaylnklqqhsdkiirlydyeitdqyiymvmecgnidlnswlkkkksi
    dpwerksywknmleavhtihqhgivhsdlkpanflivdgmlklidfgianqmqpdttsvv
    kdsqvgtvnymppeaikdmsssrengkskskispksdvwslgcilyymtygktpfqqiin
    qisklhaiidpnheiefpdipekdlqdvlkcclkrdpkqrisipellahpyvqiqthpvn
    qmakgttee
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gvjA (A:)
    necisvkgriysilkqigsggsskvfqvlnekkqiyaikyvnleeadnqtldsyrneiay
    lnklqqhsdkiirlydyeitdqyiymvmecgnidlnswlkkkksidpwerksywknmlea
    vhtihqhgivhsdlkpanflivdgmlklidfgianqmqpdttsvvkdsqvgtvnymppea
    ikdmsskispksdvwslgcilyymtygktpfqqiinqisklhaiidpnheiefpdipekd
    lqdvlkcclkrdpkqrisipellahpyvqiqt