PDB entry 6gvd

View 6gvd on RCSB PDB site
Description: Alpha-galactosidase from Thermotoga maritima in complex with cyclohexene-based carbasugar mimic of galactose
Class: hydrolase
Keywords: glycoside hydrolase, galactosidase, carbohydrate processing enzyme, inhibitor, HYDROLASE
Deposited on 2018-06-20, released 2018-08-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-08-22, with a file datestamp of 2018-08-17.
Experiment type: XRAY
Resolution: 1.22 Å
R-factor: N/A
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-galactosidase
    Species: Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) [TaxId:243274]
    Gene: galA, TM_1192, Tmari_1199
    Database cross-references and differences (RAF-indexed):
    • Uniprot G4FEF4 (23-End)
      • expression tag (17-22)
    Domains in SCOPe 2.08: d6gvda1, d6gvda2, d6gvda3
  • Heterogens: FDK, SO4, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gvdA (A:)
    mgsshhhhhhssglvprgshmasmeifgktfregrfvlkeknftvefavekihlgwkisg
    rvkgspgrlevlrtkapekvlvnnwqswgpcrvvdafsfkppeidpnwrytasvvpdvle
    rnlqsdyfvaeegkvygflsskiahpffavedgelvayleyfdvefddfvpleplvvled
    pntplllekyaelvgmennarvpkhtptgwcswyhyfldltweetlknlklaknfpfevf
    qiddayekdigdwlvtrgdfpsveemakviaengfipgiwtapfsvsetsdvfnehpdwv
    vkengepkmayrnwnkkiyaldlskdevlnwlfdlfsslrkmgyryfkidflfagavpge
    rkknitpiqafrkgietirkavgedsfilgcgspllpavgcvdgmrigpdtapfwgehie
    dngapaarwalrnaitryfmhdrfwlndpdclilreektdltqkekelysytcgvldnmi
    iesddlslvrdhgkkvlketlellggrprvqnimsedlryeivssgtlsgnvkivvdlns
    reyhlekegksslkkrvvkredgrnfyfyeegere
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gvdA (A:)
    gshmasmeifgktfregrfvlkeknftvefavekihlgwkisgrvkgspgrlevlrtkap
    ekvlvnnwqswgpcrvvdafsfkppeidpnwrytasvvpdvlernlqsdyfvaeegkvyg
    flsskiahpffavedgelvayleyfdvefddfvpleplvvledpntplllekyaelvgme
    nnarvpkhtptgwcswyhyfldltweetlknlklaknfpfevfqiddayekdigdwlvtr
    gdfpsveemakviaengfipgiwtapfsvsetsdvfnehpdwvvkengepkmayrnwnkk
    iyaldlskdevlnwlfdlfsslrkmgyryfkidflfagavpgerkknitpiqafrkgiet
    irkavgedsfilgcgspllpavgcvdgmrigpdtapfwgehiedngapaarwalrnaitr
    yfmhdrfwlndpdclilreektdltqkekelysytcgvldnmiiesddlslvrdhgkkvl
    ketlellggrprvqnimsedlryeivssgtlsgnvkivvdlnsreyhleke