PDB entry 6gv8

View 6gv8 on RCSB PDB site
Description: characterization of extracellular matrix binding protein- (embp)- mediated staphylococcus epidermidis adherence to fibronectin
Deposited on 2018-06-20, released 2019-07-03
The last revision was dated 2021-01-13, with a file datestamp of 2021-01-08.
Experiment type: XRAY
Resolution: 1.39 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hyperosmolarity resistance protein Emb
    Species: Staphylococcus epidermidis [TaxId:1282]
    Gene: ebh, CTJ08_00575
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6gv8A (A:)
tkvnktelinarrrldeeiskenktpssirnfdqamnraqsqintaksdadqvigtefat
pqqvnsalskvqaaqnkineakallqnkadnsqlvrakeqlqqsiqpaastdgmtqdstr
nyknkrqaaeqaiqhansvinngdatsqqindakntveqaqrdyveaksn

    Sequence, based on observed residues (ATOM records):
    >6gv8A (A:)
vnktelinarrrldeeiskenktpssirnfdqamnraqsqintaksdadqvigtefatpq
qvnsalskvqaaqnkineakallqnkadnsqlvrakeqlqqsidstrnyknkrqaaeqai
qhansvinngdatsqqindakntveqaqrdyveaksn