PDB entry 6gv7

View 6gv7 on RCSB PDB site
Description: Cadmium(II) form of A44H mutant of shortened metallothionein from Pseudomonas fluorescens Q2-87 (residues 1-52)
Class: metal binding protein
Keywords: metallothionein, cadmium(II) ion, METAL BINDING PROTEIN
Deposited on 2018-06-20, released 2018-09-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: metallothionein
  Species: Pseudomonas fluorescens Q2-87 [TaxId:1038922]
  Gene: PflQ2_2045
  Database cross-references and differences (RAF-indexed):
  • Uniprot J2EKT7 (0-51)
    • engineered mutation (43)
  Domains in SCOPe 2.08: d6gv7a_
• Heterogens: CD

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6gv7A (A:)
  nelrcgcpdchckvdpervfnhdgeaycsqacaeqhpngepcphpdchcers