PDB entry 6gv4

View 6gv4 on RCSB PDB site
Description: High-resolution Cryo-EM of Fab-labeled human parechovirus 3
Class: virus
Keywords: human parechovirus, antibody, RNA, VIRUS
Deposited on 2018-06-20, released 2018-11-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-24.
Experiment type: EM
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vp0
    Species: Human parechovirus 3 [TaxId:195055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8BES5 (Start-288)
      • conflict (284)
  • Chain 'B':
    Compound: vp1
    Species: Human parechovirus 3 [TaxId:195055]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: vp3
    Species: Human parechovirus 3 [TaxId:195055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8BES5 (Start-255)
      • conflict (117)
      • conflict (120)
      • conflict (122)
      • conflict (128)
      • conflict (133)
      • conflict (140)
  • Chain 'D':
    Compound: RNA (5'-r(*up*gp*gp*up*ap*up*up*u)-3')
    Species: Human parechovirus 3 [TaxId:195055]
  • Chain 'H':
    Compound: AT12-015 antibody variable heavy
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6GV4
    Domains in SCOPe 2.08: d6gv4h_
  • Chain 'L':
    Compound: AT12-015 antibody variable light
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6GV4
    Domains in SCOPe 2.08: d6gv4l_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download) 
    >6gv4H (H:)
evqllesggglvqpggslrlscaasgftfssyamswvrqapgkglewvsaisgggdsryy
adsvkgrftisrdnskntlylqmnslgaedtalyycakrlgrvaeyyfdywgqgtlvtvs
p

    Sequence, based on observed residues (ATOM records): (download) 
    >6gv4H (H:)
vqllesggglvqpggslrlscaasgftfssyamswvrqapgkglewvsaisgggdsryya
dsvkgrftisrdnskntlylqmnslgaedtalyycakrlgrvaeyyfdywgqgtlvtv

  • Chain 'L':
    Sequence, based on SEQRES records: (download) 
    >6gv4L (L:)
diqmtqspstlsasvgdrvtitcrtsqsisnwlawyqqkpgkapklliyqastlengvps
rftgsgsgtefsltisslqpddfatyycqqynnymaltfgggtkveikrtvaa

    Sequence, based on observed residues (ATOM records): (download) 
    >6gv4L (L:)
iqmtqspstlsasvgdrvtitcrtsqsisnwlawyqqkpgkapklliyqastlengvpsr
ftgsgsgtefsltisslqpddfatyycqqynnymaltfgggtkveikr