PDB entry 6gv3

View 6gv3 on RCSB PDB site
Description: Structure of the E2 conjugating enzyme, SCE1, from Arabidopsis thaliana.
Class: transferase
Keywords: SUMO conjugating enzyme, TRANSFERASE
Deposited on 2018-06-20, released 2019-07-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-03, with a file datestamp of 2019-06-28.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SUMO-conjugating enzyme SCE1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: SCE1, AHUS5, EMB1637, At3g57870, T10K17.80
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gv3a1, d6gv3a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gv3A (A:)
    mgsshhhhhhssglvprgshmasgiargrlaeerkswrknhphgfvakpetgqdgtvnlm
    vwhctipgkagtdweggffpltmhfsedypskppkckfpqgffhpnvypsgtvclsilne
    dygwrpaitvkqilvgiqdlldtpnpadpaqtdgyhlfcqdpveykkrvklqskqypalv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gv3A (A:)
    sgiargrlaeerkswrknhphgfvakpetgqdgtvnlmvwhctipgkagtdweggffplt
    mhfsedypskppkckfpqgffhpnvypsgtvclsilnedygwrpaitvkqilvgiqdlld
    tpnpadpaqtdgyhlfcqdpveykkrvklqskqypa