PDB entry 6gv2

View 6gv2 on RCSB PDB site
Description: Sulfolobus solfataricus 2-keto-3-deoxygluconate aldolase Y103F,Y130F,A198F variant in complex with L-2-keto, 3-deoxy-galactonate
Class: hydrolase
Keywords: 2-keto-3-deoxygalactonate, aldolase, Sulfolobus solfataricus, HYDROLASE
Deposited on 2018-06-20, released 2019-07-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-03, with a file datestamp of 2019-06-28.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-dehydro-3-deoxy-phosphogluconate/2-dehydro-3-deoxy-6-phosphogalactonate aldolase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O54288 (Start-293)
      • engineered mutation (102)
      • engineered mutation (129)
      • engineered mutation (197)
    Domains in SCOPe 2.07: d6gv2a_
  • Chain 'B':
    Compound: 2-dehydro-3-deoxy-phosphogluconate/2-dehydro-3-deoxy-6-phosphogalactonate aldolase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O54288 (Start-293)
      • engineered mutation (102)
      • engineered mutation (129)
      • engineered mutation (197)
    Domains in SCOPe 2.07: d6gv2b_
  • Heterogens: SSH, GXV, EDO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gv2A (A:)
    mpeiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlk
    avydvtnkiifqvgglnlddairlaklskdfdivgiasyapyfyprmsekhlvkyfktlc
    evsphpvylfnyptatgkdidakvakeigcftgvkdtieniihtldykrlnpnmlvysgs
    dmliatvastgldgnvafgsnylpevtvtikklamerkidealklqflhdevieasrifg
    slssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gv2A (A:)
    peiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlka
    vydvtnkiifqvgglnlddairlaklskdfdivgiasyapyfyprmsekhlvkyfktlce
    vsphpvylfnyptatgkdidakvakeigcftgvkdtieniihtldykrlnpnmlvysgsd
    mliatvastgldgnvafgsnylpevtvtikklamerkidealklqflhdevieasrifgs
    lssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6gv2B (B:)
    mpeiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlk
    avydvtnkiifqvgglnlddairlaklskdfdivgiasyapyfyprmsekhlvkyfktlc
    evsphpvylfnyptatgkdidakvakeigcftgvkdtieniihtldykrlnpnmlvysgs
    dmliatvastgldgnvafgsnylpevtvtikklamerkidealklqflhdevieasrifg
    slssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gv2B (B:)
    peiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlka
    vydvtnkiifqvgglnlddairlaklskdfdivgiasyapyfyprmsekhlvkyfktlce
    vsphpvylfnyptatgkdidakvakeigcftgvkdtieniihtldykrlnpnmlvysgsd
    mliatvastgldgnvafgsnylpevtvtikklamerkidealklqflhdevieasrifgs
    lssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke