PDB entry 6gv0

View 6gv0 on RCSB PDB site
Description: insulin glulisine
Deposited on 2018-06-20, released 2019-07-03
The last revision was dated 2021-02-10, with a file datestamp of 2021-02-05.
Experiment type: XRAY
Resolution: 1.26 Å
R-factor: N/A
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'B':
  Compound: insulin
  Species: Homo sapiens [TaxId:9606]
  Gene: INS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-End)
    • engineered mutation (2)
    • engineered mutation (28)
• Chain 'D':
  Compound: insulin
  Species: Homo sapiens [TaxId:9606]
  Gene: INS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-End)
    • engineered mutation (2)
    • engineered mutation (28)
• Chain 'G':
  Compound: insulin
  Species: Homo sapiens [TaxId:9606]
  Gene: INS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
• Chain 'I':
  Compound: insulin
  Species: Homo sapiens [TaxId:9606]
  Gene: INS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
• Heterogens: ZN, FMT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'B':
  Sequence, based on SEQRES records:
  

  >6gv0B (B:)
  fvkqhlcgshlvealylvcgergffytpet
  

  
  Sequence, based on observed residues (ATOM records):
  

  >6gv0B (B:)
  fvkqhlcgshlvealylvcgergffytpe
  

  
  
• Chain 'D':
  Sequence, based on SEQRES records:
  

  >6gv0D (D:)
  fvkqhlcgshlvealylvcgergffytpet
  

  
  Sequence, based on observed residues (ATOM records):
  

  >6gv0D (D:)
  fvkqhlcgshlvealylvcgergffytpe
  

  
  
• Chain 'G':
  Sequence; same for both SEQRES and ATOM records:
  

  >6gv0G (G:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'I':
  Sequence; same for both SEQRES and ATOM records:
  

  >6gv0I (I:)
  giveqcctsicslyqlenycn