PDB entry 6guz

View 6guz on RCSB PDB site
Description: Ground state structure of Archaerhodopsin-3 obtained from LCP crystals using a thin-film sandwich at room temperature
Class: proton transport
Keywords: Membrane Protein, Rhodopsin, Archaerhodopsin, Retinal, LCP, Room temperature, Synchrotron, PROTON TRANSPORT
Deposited on 2018-06-19, released 2019-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-10-09, with a file datestamp of 2019-10-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Archaerhodopsin-3
    Species: Halorubrum sodomense [TaxId:35743]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P96787 (0-End)
      • conflict (0)
    Domains in SCOPe 2.07: d6guza_
  • Heterogens: RET, R16, DD9, D10, CA, NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6guzA (A:)
    eagydllgdgrpetlwlgigtllmligtfyflvrgwgvtdkdareyyavtilvpgiasaa
    ylsmffgigltevtvggemldiyyaryadwlfttplllldlallakvdrvtigtlvgvda
    lmivtgligalshtaiaryswwlfsticmivvlyflatslrsaakergpevastfntlta
    lvlvlwtaypilwiigtegagvvglgietllfmvldvtakvgfgfillrsrailgdteap
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >6guzA (A:)
    eagydllgdgrpetlwlgigtllmligtfyflvrgwgvtdkdareyyavtilvpgiasaa
    ylsmffgigltevtvggemldiyyaryadwlfttplllldlallakvdrvtigtlvgvda
    lmivtgligalshtaiaryswwlfsticmivvlyflatslrsaakergpevastfntlta
    lvlvlwtaypilwiigtegagvvglgietllfmvldvtakvgfgfillrsrailgdteap