PDB entry 6gux

View 6gux on RCSB PDB site
Description: Dark-adapted structure of Archaerhodopsin-3 at 100K
Class: proton transport
Keywords: Membrane Protein, Rhodopsin, Archaerhodopsin, Retinal, LCP, Synchrotron, Cryo, PROTON TRANSPORT
Deposited on 2018-06-19, released 2019-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-10-09, with a file datestamp of 2019-10-04.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Archaerhodopsin-3
    Species: Halorubrum sodomense [TaxId:35743]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P96787 (0-240)
      • modified residue (0)
    Domains in SCOPe 2.07: d6guxa_
  • Heterogens: RET, R16, D12, DD9, CA, NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6guxA (A:)
    eagydllgdgrpetlwlgigtllmligtfyflvrgwgvtdkdareyyavtilvpgiasaa
    ylsmffgigltevtvggemldiyyaryadwlfttplllldlallakvdrvtigtlvgvda
    lmivtgligalshtaiaryswwlfsticmivvlyflatslrsaakergpevastfntlta
    lvlvlwtaypilwiigtegagvvglgietllfmvldvtakvgfgfillrsrailgdteap
    e