PDB entry 6guw

View 6guw on RCSB PDB site
Description: BTB domain of zebrafish PATZ1
Class: transcription
Keywords: Patz1, BTB, zebrafish, TRANSCRIPTION
Deposited on 2018-06-19, released 2019-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: POZ (BTB) and AT hook-containing zinc finger 1
    Species: Danio rerio [TaxId:7955]
    Gene: patz1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6guwa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6guwA (A:)
    mahhhhhhsaalevlfqgpgmerteqpwnssytyqvskhsaemlhnlngqrkdggrfcdv
    ilrvgeesfpahkavlaacseyfesvfscqteddgqgkelemhtispkvfrdildfayts
    kivvrlecfpelmtaakfllmrsvieicqevikqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6guwA (A:)
    sytyqvskhsaemlhnlngqrkdggrfcdvilrvgeesfpahkavlaacseyfesvfscg
    kelemhtispkvfrdildfaytskivvrlecfpelmtaakfllmrsvieicqevikqs