PDB entry 6guv

View 6guv on RCSB PDB site
Description: btb domain of mouse patz1
Deposited on 2018-06-19, released 2019-10-09
The last revision was dated 2020-10-21, with a file datestamp of 2020-10-16.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: POZ (BTB) and AT hook-containing zinc finger 1
    Species: Mus musculus [TaxId:10090]
    Gene: Patz1, mazr, Zfp278, mCG_14719
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JMG9 (20-174)
      • expression tag (10-19)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6guvA (A:)
mahhhhhhsaalevlfqgpgsgcytyqvsrhstemlhnlnqqrknggrfcdvllrvgdes
fpahravlaacseyfesvfsaqlgdggaadggpadvggaaaapgggaggsrelemhtiss
kvfgdildfaytsrivvrlesfpelmtaakfllmrsvieicqevikqsnvqilvp

    Sequence, based on observed residues (ATOM records):
    >6guvA (A:)
alevlfqgpgsgcytyqvsrhstemlhnlnqqrknggrfcdvllrvgdesfpahravlaa
cseyfesvfsaqlmhtisskvfgdildfaytsrivvrlesfpelmtaakfllmrsvieic
qevikqsnvqilvp