PDB entry 6gus

View 6gus on RCSB PDB site
Description: crystal structure of protein e from non-typeable haemophilus influenzae
Deposited on 2018-06-19, released 2019-05-29
The last revision was dated 2019-07-31, with a file datestamp of 2019-07-26.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Surface-adhesin protein
    Species: Haemophilus influenzae [TaxId:727]
    Gene: PE
    Database cross-references and differences (RAF-indexed):
    • Uniprot S5ZIQ9 (6-141)
      • expression tag (5)
      • expression tag (142-151)
  • Heterogens: SO4, GOL, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6gusA (A:)
qiqkaeqndvklapptdvrsgyirlvknvnyyidsesiwvdnqepqivhfdavvnldkgl
yvypepkryarsvrqykilncanyhltqvrtdfydefwgqglraapkkqkkhtlsltpdt
tlynaaqiicanygeafsvdkkklaaalehhhhhh

    Sequence, based on observed residues (ATOM records):
    >6gusA (A:)
eqndvklapptdvrsgyirlvknvnyyidsesiwvdnqepqivhfdavvnldkglyvype
pkryarsvrqykilncanyhltqvrtdfydefwgqglraapkkqkkhtlsltpdttlyna
aqiicanygeafsvdkkklaaalehhh