PDB entry 6guq

View 6guq on RCSB PDB site
Description: Crystal structure of GanP, a glucose-galactose binding protein from Geobacillus stearothermophilus, in complex with glucose
Class: sugar binding protein
Keywords: Glucose-galactose binding protein, Geobacillus stearothermophilus, three-component sensing system, galactan utilization system, SUGAR BINDING PROTEIN
Deposited on 2018-06-19, released 2019-07-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-03, with a file datestamp of 2019-06-28.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative sugar binding protein
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: ganP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6guqa_
  • Heterogens: BGC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6guqA (A:)
    mghhhhhhawnvyaypksekervpettkeayhfvlvpeeldndywrlvekgakaaakelg
    vdleyigprqanidehlrilkkaaaakvdgiitqglteaefvpvineitdknipvvtidt
    daptsrrvayvgtdnyyagflagralaedtkgkatvaiitgsltaahqqlrvrgfedavr
    qekgirivaieeshitrvqaaekaytilkkhpdvnafygtsaldaigvakvveqfhreqk
    tyiigfdtlpetirylqkgtiaatvvqepyemgykavkmmaeivagkdvpvvtntetkvi
    rkkdlplrparnyevntp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6guqA (A:)
    ayhfvlvpeeldndywrlvekgakaaakelgvdleyigprqanidehlrilkkaaaakvd
    giitqglteaefvpvineitdknipvvtidtdaptsrrvayvgtdnyyagflagralaed
    tkgkatvaiitgsltaahqqlrvrgfedavrqekgirivaieeshitrvqaaekaytilk
    khpdvnafygtsaldaigvakvveqfhreqktyiigfdtlpetirylqkgtiaatvvqep
    yemgykavkmmaeivagkdvpvvtntetkvirkkdlpl