PDB entry 6gum

View 6gum on RCSB PDB site
Description: Structure of the A.thaliana E1 UFD domain in complex with E2
Class: transferase
Keywords: SUMOylation complex, Transferase
Deposited on 2018-06-19, released 2019-07-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-15, with a file datestamp of 2020-01-10.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SUMO-conjugating enzyme SCE1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: SCE1, AHUS5, EMB1637, At3g57870, T10K17.80
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6guma_
  • Chain 'B':
    Compound: sae2
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AXX17_At2g16970
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6gumA (A:)
mgsshhhhhhssglvprgshmasgiargrlaeerkswrknhphgfvakpetgqdgtvnlm
vwhctipgkagtdweggffpltmhfsedypskppkckfpqgffhpnvypsgtvclsilne
dygwrpaitvkqilvgiqdlldtpnpadpaqtdgyhlfcqdpveykkrvklqskqypalv

    Sequence, based on observed residues (ATOM records): (download) 
    >6gumA (A:)
giargrlaeerkswrknhphgfvakpetgqdgtvnlmvwhctipgkagtdweggffpltm
hfsedypskppkckfpqgffhpnvypsgtvclsilnedygwrpaitvkqilvgiqdlldt
pnpadpaqtdgyhlfcqdpveykkrvklqskqypa

  • Chain 'B':
    No sequence available.