PDB entry 6gu6

View 6gu6 on RCSB PDB site
Description: CDK1/Cks2 in complex with Dinaciclib
Class: cell cycle
Keywords: cdk1, cks2, inhibitor, cell cycle
Deposited on 2018-06-19, released 2018-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-05, with a file datestamp of 2018-11-30.
Experiment type: XRAY
Resolution: 2.33 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cyclin-dependent kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK1, CDC2, CDC28A, CDKN1, P34CDC2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gu6a_
  • Chain 'B':
    Compound: cyclin-dependent kinases regulatory subunit
    Species: Desmodus rotundus [TaxId:9430]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gu6b_
  • Heterogens: 1QK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gu6A (A:)
    gplgsmedytkiekigegtygvvykgrhkttgqvvamkkirleseeegvpstaireisll
    kelrhpnivslqdvlmqdsrlylifeflsmdlkkyldsippgqymdsslvksylyqilqg
    ivfchsrrvlhrdlkpqnlliddkgtikladfglarafgipirvythevvtlwyrspevl
    lgsarystpvdiwsigtifaelatkkplfhgdseidqlfrifralgtpnnevwpeveslq
    dykntfpkwkpgslashvknldengldllskmliydpakrisgkmalnhpyfndldnqik
    km
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gu6A (A:)
    medytkiekigegtygvvykgrhkttgqvvamkkirleseeegvpstaireisllkelrh
    pnivslqdvlmqdsrlylifeflsmdlkkyldsippgqymdsslvksylyqilqgivfch
    srrvlhrdlkpqnlliddkgtikladfglarafgipithevvtlwyrspevllgsaryst
    pvdiwsigtifaelatkkplfhgdseidqlfrifralgtpnnevwpeveslqdykntfpk
    wkpgslashvknldengldllskmliydpakrisgkmalnhpyfndld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6gu6B (B:)
    gplgsmahkqiyysdkyfdehyeyrhvmlprelskqvpkthlmseeewrrlgvqqslgwv
    hymihepephillfrrplpkdqqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gu6B (B:)
    qiyysdkyfdehyeyrhvmlprelskqvpkthlmseeewrrlgvqqslgwvhymihepep
    hillfrrplp