PDB entry 6gu5

View 6gu5 on RCSB PDB site
Description: Mosto containing the core POM clusters
Class: metal binding protein
Keywords: Molybdenum storage, polyoxometalate clusters, ATP binding, METAL BINDING PROTEIN
Deposited on 2018-06-19, released 2018-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-07, with a file datestamp of 2018-11-02.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Molybdenum storage protein subunit alpha
    Species: Azotobacter vinelandii DJ [TaxId:322710]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gu5a_
  • Chain 'B':
    Compound: Molybdenum storage protein subunit beta
    Species: Azotobacter vinelandii DJ [TaxId:322710]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ATP, 8M0, PO4, MOO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gu5A (A:)
    tdttnsikhvisplarqtlqdrdltrpvagkrpirllpwlqvvkiggrvmdrgadailpl
    veelrkllpehrlliltgagvrarhvfsvgldlglpvgslaplaaseagqnghilaamla
    segvsyvehptvadqlaihlsatravvgsafppyhhhefpgsripphradtgaflladaf
    gaagltivenvdgiytadpngpdrgqarflpetsatdlaksegplpvdralldvmatarh
    iervqvvnglvpgrltaalrgehvgtlirtgvrpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gu5A (A:)
    krpirllpwlqvvkiggrvmdrgadailplveelrkllpehrlliltgagvrarhvfsvg
    ldlglpvgslaplaaseagqnghilaamlasegvsyvehptvadqlaihlsatravvgsa
    fppyhhhefpgsripphradtgaflladafgaagltivenvdgiytadpngpdrgqarfl
    petsatdlaksegplpvdralldvmatarhiervqvvnglvpgrltaalrgehvgtlirt
    gvrpa
    

  • Chain 'B':
    No sequence available.