PDB entry 6gu0

View 6gu0 on RCSB PDB site
Description: crystal structure of a fimh*dsg complex from e.coli f18 with bound dimannoside man(alpha1-3)man in space group p213
Deposited on 2018-06-19, released 2019-01-16
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FimH PROTEIN
    Species: Escherichia coli F18+ [TaxId:488477]
    Gene: ECP_4655, fimh
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: FimG protein
    Species: Escherichia coli 536, synthetic [TaxId:362663]
    Database cross-references and differences (RAF-indexed):
    • PDB 6GU0 (0-13)
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6gu0A (A:)
    facktangtaipigggsanvyvnlapavnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlssfsgtvkyngssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvptggcdvsardvtvtlpdypgsvp
    ipltvycaksqnlgyylsgttadagnsiftntasfspaqgvgvqltrngtiipanntvsl
    gavgtsavslgltanyartggqvtagnvqsiigvtfvyq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6gu0B (B:)
    advtitvngkvvak