PDB entry 6gtw

View 6gtw on RCSB PDB site
Description: Crystal structure of the FimH lectin domain from E.coli F18 in complex with trimannose
Class: cell adhesion
Keywords: type I pilus, catch-bond, cell adhesion, lectin, upec, infection, mannose
Deposited on 2018-06-19, released 2019-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FimH PROTEIN
    Species: Escherichia coli F18+ [TaxId:488477]
    Gene: ECP_4655, fimh
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gtwa_
  • Chain 'B':
    Compound: FimH PROTEIN
    Species: Escherichia coli F18+ [TaxId:488477]
    Gene: ECP_4655, fimh
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gtwb_
  • Chain 'C':
    Compound: FimH PROTEIN
    Species: Escherichia coli F18+ [TaxId:488477]
    Gene: ECP_4655, fimh
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gtwc_
  • Chain 'D':
    Compound: FimH PROTEIN
    Species: Escherichia coli F18+ [TaxId:488477]
    Gene: ECP_4655, fimh
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gtwd_
  • Heterogens: CA, MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gtwA (A:)
    facktangtaipigggsanvyvnlapavnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlssfsgtvkyngssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvptg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gtwA (A:)
    facktangtaipigggsanvyvnlapavnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlssfsgtvkyngssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvpt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6gtwB (B:)
    facktangtaipigggsanvyvnlapavnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlssfsgtvkyngssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvptg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6gtwC (C:)
    facktangtaipigggsanvyvnlapavnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlssfsgtvkyngssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvptg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gtwC (C:)
    facktangtaipigggsanvyvnlapavnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlssfsgtvkyngssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvpt
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6gtwD (D:)
    facktangtaipigggsanvyvnlapavnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlssfsgtvkyngssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvptg