PDB entry 6gtt

View 6gtt on RCSB PDB site
Description: Human STK10 bound to BIRB-796
Class: transferase
Keywords: Kinase, Structural Genomics Consortium, SGC, TRANSFERASE
Deposited on 2018-06-19, released 2018-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase 10
    Species: Homo sapiens [TaxId:9606]
    Gene: STK10, LOK
    Database cross-references and differences (RAF-indexed):
    • Uniprot O94804 (2-End)
      • expression tag (0-1)
      • conflict (256)
    Domains in SCOPe 2.07: d6gtta1, d6gtta2
  • Heterogens: B96, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gttA (A:)
    smrksreyehvrrdldpnevweivgelgdgafgkvykaknketgalaaakvietkseeel
    edyiveieilatcdhpyivkllgayyhdgklwimiefcpggavdaimleldrgltepqiq
    vvcrqmlealnflhskriihrdlkagnvlmtlegdirladfgvsaknlktlqkrdsfigt
    pywmapevvmcetmkdtpydykadiwslgitliemaqiepphhelnpmrvllkiaksdpp
    tlltpskwsvefrdflaialdknpetrpsaaqllehpfvssitsnkalrelvaeakaevm
    ee
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gttA (A:)
    smrksreyehvrrdldpnevweivgelgdgafgkvykaknketgalaaakvietkseeel
    edyiveieilatcdhpyivkllgayyhdgklwimiefcpggavdaimleldrgltepqiq
    vvcrqmlealnflhskriihrdlkagnvlmtlegdirladfgtpywmapevvmcetdtpy
    dykadiwslgitliemaqiepphhelnpmrvllkiaksdpptlltpskwsvefrdflaia
    ldknpetrpsaaqllehpfvssitsnkalrelvaeakaevme