PDB entry 6gto

View 6gto on RCSB PDB site
Description: structure of the atar antitoxin
Deposited on 2018-06-18, released 2019-03-06
The last revision was dated 2019-03-06, with a file datestamp of 2019-03-01.
Experiment type: XRAY
Resolution: 2.97 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DUF1778 domain-containing protein
    Species: Escherichia coli [TaxId:562]
    Gene: ybl13, ybl13_1, A8G17_04185, AA102_09360, AC789_1c38270, ACN002_3543, ACN81_27750, ACU90_15595, AM270_07745, ARC77_13665, AU473_04475, B1K96_23180, B1K96_30445, BHS81_20640, BIZ41_06975, BK292_07330, BMT53_16880, BN17_33961, BTQ04_07040, BWP17_00645, COD46_18440, CR538_01655, CVH05_12360, ERS085366_00076, ERS085374_01548, ERS085383_01733, ERS085404_01502, RX35_03224
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NA

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6gtoA (A:)
msavkkqridlrltdddksmieeaaaisnqsvsqfmlnsasqraaevieqhrrvilnees
wtrvmdalsnppspgeklkraakrlqgm

    Sequence, based on observed residues (ATOM records):
    >6gtoA (A:)
idlrltdddksmieeaaaisnqsvsqfmlnsasqraaevieqhrrvilneeswtrvmdal
sn